SCOPe 2.08: Domain d5d71a1: 5d71 A:9-110

Lineage for d5d71a1 (5d71 A:9-110)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47290] (10 PDB entries)

8. Domain d5d71a1: 5d71 A:9-110 [278077]
   Other proteins in same PDB: d5d71a2, d5d71l1, d5d71l2
   automated match to d1csga_
   complexed with peg, so4

Details for d5d71a1

PDB Entry: 5d71, 2.25 Å

PDB Description: crystal structure of mor04302, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf

PDB Compounds: (A:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d5d71a1:

Sequence; same for both SEQRES and ATOM records:

>d5d71a1 a.26.1.2 (A:9-110) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]}
stqpwehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykqglrg
sltklkgpltmmashykqhcpptpetscatqiitfesfkenl

Timeline for d5d71a1:

• d5d71a1 first appeared in SCOPe 2.05, called d5d71a_
  
• d5d71a1 appears in SCOPe 2.07