Lineage for d5czkb3 (5czk B:274-601)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083909Species Escherichia coli [TaxId:83333] [272137] (8 PDB entries)
  8. 2083925Domain d5czkb3: 5czk B:274-601 [278076]
    Other proteins in same PDB: d5czka1, d5czka2, d5czka4, d5czkb1, d5czkb2, d5czkb4
    automated match to d4jkmb3
    complexed with 57z

Details for d5czkb3

PDB Entry: 5czk (more details), 2.39 Å

PDB Description: structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1- (2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d5czkb3:

Sequence, based on SEQRES records: (download)

>d5czkb3 c.1.8.0 (B:274-601) automated matches {Escherichia coli [TaxId: 83333]}
vavkgeqflinhkpfyftgfgrhedadlrgkgfdnvlmvhdhalmdwigansyrtshypy
aeemldwadehgivvidetaavgfnlslgigfeagnkpkelyseeavngetqqahlqaik
eliardknhpsvvmwsianepdtrpqgareyfaplaeatrkldptrpitcvnvmfcdaht
dtisdlfdvlclnryygwyvqsgdletaekvlekellawqeklhqpiiiteygvdtlagl
hsmytdmwseeyqcawldmyhrvfdrvsavvgeqvwnfadfatsqgilrvggnkkgiftr
drkpksaafllqkrwtgmnfgekpqqgg

Sequence, based on observed residues (ATOM records): (download)

>d5czkb3 c.1.8.0 (B:274-601) automated matches {Escherichia coli [TaxId: 83333]}
vavkgeqflinhkpfyftgfgrhedadlrgkgfdnvlmvhdhalmdwigansyrtshypy
aeemldwadehgivvidetaavgfnlslgigfankpkelyseeavngetqqahlqaikel
iardknhpsvvmwsianepdtrpqgareyfaplaeatrkldptrpitcvnvmfcdahtdt
isdlfdvlclnryygwyvqsgdletaekvlekellawqeklhqpiiiteygvdtlaglhs
mytdmwseeyqcawldmyhrvfdrvsavvgeqvwnfadfatsqgilrvggnkkgiftrdr
kpksaafllqkrwtgmnfgekpqqgg

SCOPe Domain Coordinates for d5czkb3:

Click to download the PDB-style file with coordinates for d5czkb3.
(The format of our PDB-style files is described here.)

Timeline for d5czkb3: