Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (31 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272122] (2 PDB entries) |
Domain d5czka1: 5czk A:-1-181 [278071] Other proteins in same PDB: d5czka2, d5czka3, d5czkb2, d5czkb3 automated match to d4jkmb1 complexed with 57z |
PDB Entry: 5czk (more details), 2.39 Å
SCOPe Domain Sequences for d5czka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5czka1 b.18.1.0 (A:-1-181) automated matches {Escherichia coli [TaxId: 83333]} shmlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfada dirnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadv tpyviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyt tpn
Timeline for d5czka1: