Lineage for d5czka1 (5czk A:-1-181)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777799Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1777800Protein automated matches [190770] (31 species)
    not a true protein
  7. 1777946Species Escherichia coli [TaxId:83333] [272122] (2 PDB entries)
  8. 1777951Domain d5czka1: 5czk A:-1-181 [278071]
    Other proteins in same PDB: d5czka2, d5czka3, d5czkb2, d5czkb3
    automated match to d4jkmb1
    complexed with 57z

Details for d5czka1

PDB Entry: 5czk (more details), 2.39 Å

PDB Description: structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1- (2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d5czka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5czka1 b.18.1.0 (A:-1-181) automated matches {Escherichia coli [TaxId: 83333]}
shmlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfada
dirnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadv
tpyviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyt
tpn

SCOPe Domain Coordinates for d5czka1:

Click to download the PDB-style file with coordinates for d5czka1.
(The format of our PDB-style files is described here.)

Timeline for d5czka1: