Lineage for d5ctca2 (5ctc A:1815-2193)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099797Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 protein domains)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2099959Protein automated matches [226926] (3 species)
    not a true protein
  7. 2099960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225864] (7 PDB entries)
  8. 2099994Domain d5ctca2: 5ctc A:1815-2193 [278066]
    automated match to d1uyra2
    complexed with 57k, so4

Details for d5ctca2

PDB Entry: 5ctc (more details), 2.7 Å

PDB Description: humanized yeast acc carboxyltransferase domain bound to tert-butyl 7- [(7-methyl-1h-indazol-5-yl)carbonyl]-2,7-diazaspiro[3.5]nonane-2- carboxylate
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d5ctca2:

Sequence, based on SEQRES records: (download)

>d5ctca2 c.14.1.4 (A:1815-2193) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqqagqvwfpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepegtveikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkglkles

Sequence, based on observed residues (ATOM records): (download)

>d5ctca2 c.14.1.4 (A:1815-2193) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqqagqvwfpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepegtveikfrreklldtmnrlddkyrkq
ladrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneey
likrlsheasrlekiarirswypasvdheddrqvatwieenyktlddklkglkles

SCOPe Domain Coordinates for d5ctca2:

Click to download the PDB-style file with coordinates for d5ctca2.
(The format of our PDB-style files is described here.)

Timeline for d5ctca2: