Lineage for d1eg4a3 (1eg4 A:47-84)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 961395Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 961396Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 961397Family b.72.1.1: WW domain [51046] (12 proteins)
  6. 961414Protein Dystrophin [51051] (1 species)
  7. 961415Species Human (Homo sapiens) [TaxId:9606] [51052] (2 PDB entries)
  8. 961417Domain d1eg4a3: 1eg4 A:47-84 [27806]
    Other proteins in same PDB: d1eg4a1, d1eg4a2

Details for d1eg4a3

PDB Entry: 1eg4 (more details), 2 Å

PDB Description: structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
PDB Compounds: (A:) dystrophin

SCOPe Domain Sequences for d1eg4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg4a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]}
pasqhflstsvqgpweraispnkvpyyinhetqttcwd

SCOPe Domain Coordinates for d1eg4a3:

Click to download the PDB-style file with coordinates for d1eg4a3.
(The format of our PDB-style files is described here.)

Timeline for d1eg4a3: