SCOPe 2.07: Domain d5cryb_: 5cry B:

Lineage for d5cryb_ (5cry B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53891] (20 PDB entries)

8. Domain d5cryb_: 5cry B: [278055]
   automated match to d1nkxa_
   complexed with bct, bma, fe, nag

Details for d5cryb_

PDB Entry: 5cry, 2.79 Å

PDB Description: structure of iron-saturated c-lobe of bovine lactoferrin at ph 6.8 indicates the softening of iron coordination

PDB Compounds: (B:) lactotransferrin

SCOPe Domain Sequences for d5cryb_:

Sequence; same for both SEQRES and ATOM records:

>d5cryb_ c.94.1.2 (B:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacafltr

Timeline for d5cryb_:

• d5cryb_ first appeared in SCOPe 2.05
  
• d5cryb_ appears in SCOPe 2.06
  
• d5cryb_ appears in the current release, SCOPe 2.08