Lineage for d1eg3a3 (1eg3 A:47-84)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63149Fold b.72: WW domain-like [51044] (2 superfamilies)
  4. 63150Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 63151Family b.72.1.1: WW domain [51046] (5 proteins)
  6. 63152Protein Dystrophin [51051] (1 species)
  7. 63153Species Human (Homo sapiens) [TaxId:9606] [51052] (2 PDB entries)
  8. 63154Domain d1eg3a3: 1eg3 A:47-84 [27805]
    Other proteins in same PDB: d1eg3a1, d1eg3a2

Details for d1eg3a3

PDB Entry: 1eg3 (more details), 2 Å

PDB Description: structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide

SCOP Domain Sequences for d1eg3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens)}
pasqhflstsvqgpweraispnkvpyyinhetqttcwd

SCOP Domain Coordinates for d1eg3a3:

Click to download the PDB-style file with coordinates for d1eg3a3.
(The format of our PDB-style files is described here.)

Timeline for d1eg3a3: