Lineage for d5c7xl2 (5c7x L:109-208)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765166Domain d5c7xl2: 5c7x L:109-208 [278048]
    Other proteins in same PDB: d5c7xa_, d5c7xb_
    automated match to d3s96b2
    complexed with peg, pg6, pge

Details for d5c7xl2

PDB Entry: 5c7x (more details), 2.95 Å

PDB Description: crystal structure of mor04357, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf
PDB Compounds: (L:) Immunglobulin G1 Fab fragment, light chain

SCOPe Domain Sequences for d5c7xl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c7xl2 b.1.1.0 (L:109-208) automated matches {Homo sapiens [TaxId: 9606]}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d5c7xl2:

Click to download the PDB-style file with coordinates for d5c7xl2.
(The format of our PDB-style files is described here.)

Timeline for d5c7xl2: