Lineage for d5c7xl2 (5c7x L:109-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759066Domain d5c7xl2: 5c7x L:109-208 [278048]
    Other proteins in same PDB: d5c7xa1, d5c7xa2, d5c7xb1, d5c7xb2
    automated match to d3s96b2
    complexed with peg, pg6, pge

Details for d5c7xl2

PDB Entry: 5c7x (more details), 2.95 Å

PDB Description: crystal structure of mor04357, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf
PDB Compounds: (L:) Immunglobulin G1 Fab fragment, light chain

SCOPe Domain Sequences for d5c7xl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c7xl2 b.1.1.0 (L:109-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d5c7xl2:

Click to download the PDB-style file with coordinates for d5c7xl2.
(The format of our PDB-style files is described here.)

Timeline for d5c7xl2: