SCOPe 2.05: Domain d5caab_: 5caa B:

Lineage for d5caab_ (5caa B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (15 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [189935] (7 PDB entries)

8. Domain d5caab_: 5caa B: [278042]
   automated match to d3ngsa_
   mutant

Details for d5caab_

PDB Entry: 5caa, 2.3 Å

PDB Description: structure of leishmania nucleoside diphosphate kinase mutant p100s/del5-cterm

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5caab_:

Sequence; same for both SEQRES and ATOM records:

>d5caab_ d.58.6.1 (B:) automated matches {Leishmania major [TaxId: 5664]}
ssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpffp
alvkyfssgpivcmvwegknvvksgrvllgatnpadsqsgtirgdfavdvgrnvchgsds
vesaereiafwfkadeia

Timeline for d5caab_:

• d5caab_ is new in SCOPe 2.05-stable
  
• d5caab_ appears in SCOPe 2.06
  
• d5caab_ appears in the current release, SCOPe 2.08, called d5caab1