Lineage for d5caaa1 (5caa A:3-138)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518280Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2518281Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2518531Protein automated matches [190032] (18 species)
    not a true protein
  7. 2518678Species Leishmania major [TaxId:5664] [189935] (7 PDB entries)
  8. 2518682Domain d5caaa1: 5caa A:3-138 [278039]
    Other proteins in same PDB: d5caaa2, d5caab2
    automated match to d3ngsa_
    mutant

Details for d5caaa1

PDB Entry: 5caa (more details), 2.3 Å

PDB Description: structure of leishmania nucleoside diphosphate kinase mutant p100s/del5-cterm
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5caaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5caaa1 d.58.6.1 (A:3-138) automated matches {Leishmania major [TaxId: 5664]}
sertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpffpa
lvkyfssgpivcmvwegknvvksgrvllgatnpadsqsgtirgdfavdvgrnvchgsdsv
esaereiafwfkadei

SCOPe Domain Coordinates for d5caaa1:

Click to download the PDB-style file with coordinates for d5caaa1.
(The format of our PDB-style files is described here.)

Timeline for d5caaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5caaa2