Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Hyphomonas neptunium [TaxId:228405] [237710] (2 PDB entries) |
Domain d5c9gc_: 5c9g C: [278038] Other proteins in same PDB: d5c9ga2, d5c9gb2, d5c9gd2, d5c9gf2 automated match to d4olqa_ complexed with mlt, pg4 |
PDB Entry: 5c9g (more details), 2.1 Å
SCOPe Domain Sequences for d5c9gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c9gc_ c.14.1.0 (C:) automated matches {Hyphomonas neptunium [TaxId: 228405]} tlpirldiaaplaeivlnkperrnalsvdmwaaipglvaeananpdvklilihggdagaf aagadisefetiyatedaakasgqriaqaldaiensekpviaaiegacvgggvslamaad lrvagegakfgvtpgklglvypagdtrrllaavgpgatkdilftgriftageakslglid rlvekgtaleaarvwageiaaisqwsvratkrmirglqtgwtdetpeaqslflngfaned fkegyrafldkrpakftyr
Timeline for d5c9gc_: