Lineage for d5c9gc_ (5c9g C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853790Species Hyphomonas neptunium [TaxId:228405] [237710] (2 PDB entries)
  8. 2853793Domain d5c9gc_: 5c9g C: [278038]
    Other proteins in same PDB: d5c9ga2, d5c9gb2, d5c9gd2, d5c9gf2
    automated match to d4olqa_
    complexed with mlt, pg4

Details for d5c9gc_

PDB Entry: 5c9g (more details), 2.1 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase family protein from hyphomonas neptunium
PDB Compounds: (C:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d5c9gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c9gc_ c.14.1.0 (C:) automated matches {Hyphomonas neptunium [TaxId: 228405]}
tlpirldiaaplaeivlnkperrnalsvdmwaaipglvaeananpdvklilihggdagaf
aagadisefetiyatedaakasgqriaqaldaiensekpviaaiegacvgggvslamaad
lrvagegakfgvtpgklglvypagdtrrllaavgpgatkdilftgriftageakslglid
rlvekgtaleaarvwageiaaisqwsvratkrmirglqtgwtdetpeaqslflngfaned
fkegyrafldkrpakftyr

SCOPe Domain Coordinates for d5c9gc_:

Click to download the PDB-style file with coordinates for d5c9gc_.
(The format of our PDB-style files is described here.)

Timeline for d5c9gc_: