Lineage for d5c7pc_ (5c7p C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173863Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2173864Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2174114Protein automated matches [190032] (18 species)
    not a true protein
  7. 2174242Species Leishmania major [TaxId:5664] [189935] (7 PDB entries)
  8. 2174269Domain d5c7pc_: 5c7p C: [278033]
    automated match to d1zs6a1
    mutant

Details for d5c7pc_

PDB Entry: 5c7p (more details), 3.14 Å

PDB Description: structure of leishmania nucleoside diphostate kinase mutant p95s
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5c7pc_:

Sequence, based on SEQRES records: (download)

>d5c7pc_ d.58.6.1 (C:) automated matches {Leishmania major [TaxId: 5664]}
mssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpff
palvkyfssgpivcmvwegknvvksgrvllgatnsadsqpgtirgdfavdvgrnvchgsd
svesaereiafwfkadeiaswtshsvsqiy

Sequence, based on observed residues (ATOM records): (download)

>d5c7pc_ d.58.6.1 (C:) automated matches {Leishmania major [TaxId: 5664]}
mssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpff
palvkyfssgpivcmvwegknvvksgrvllgsqpgtirgdfavdvgrnvchgsdsvesae
reiafwfkadeiaswtshsvsqiy

SCOPe Domain Coordinates for d5c7pc_:

Click to download the PDB-style file with coordinates for d5c7pc_.
(The format of our PDB-style files is described here.)

Timeline for d5c7pc_: