SCOPe 2.06: Domain d5bw7a1: 5bw7 A:233-339

Lineage for d5bw7a1 (5bw7 A:233-339)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (57 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d5bw7a1: 5bw7 A:233-339 [278030]
   Other proteins in same PDB: d5bw7a2, d5bw7b2, d5bw7c1, d5bw7c2
   automated match to d1hzhh3
   complexed with bma, cl, fuc, gal, man, nag; mutant

Details for d5bw7a1

PDB Entry: 5bw7, 3 Å

PDB Description: crystal structure of nonfucosylated fc y296w mutant complexed with bis-glycosylated soluble form of fc gamma receptor iiia

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5bw7a1:

Sequence; same for both SEQRES and ATOM records:

>d5bw7a1 b.1.1.2 (A:233-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpr
eeqwnstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d5bw7a1:

• d5bw7a1 first appeared in SCOPe 2.05
  
• d5bw7a1 appears in SCOPe 2.07
  
• d5bw7a1 appears in the current release, SCOPe 2.08