SCOP 1.57: Domain d1f8ab1: 1f8a B:1-42

Lineage for d1f8ab1 (1f8a B:1-42)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.72: WW domain-like [51044] (2 superfamilies)

4. Superfamily b.72.1: WW domain [51045] (1 family)

5. Family b.72.1.1: WW domain [51046] (5 proteins)

6. Protein Mitotic rotamase PIN1 [51047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51048] (5 PDB entries)

8. Domain d1f8ab1: 1f8a B:1-42 [27803]
   Other proteins in same PDB: d1f8ab2

Details for d1f8ab1

PDB Entry: 1f8a, 1.84 Å

PDB Description: structural basis for the phosphoserine-proline recognition by group iv ww domains

SCOP Domain Sequences for d1f8ab1:

Sequence; same for both SEQRES and ATOM records:

>d1f8ab1 b.72.1.1 (B:1-42) Mitotic rotamase PIN1 {Human (Homo sapiens)}
gshgmadeeklppgwekrmsrssgrvyyfnhitnasqwerps

Timeline for d1f8ab1:

• d1f8ab1 first appeared (with stable ids) in SCOP 1.55
  
• d1f8ab1 appears in SCOP 1.59
  
• d1f8ab1 appears in the current release, SCOPe 2.08