SCOPe 2.06: Domain d5bw7c1: 5bw7 C:10-86

Lineage for d5bw7c1 (5bw7 C:10-86)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (30 PDB entries)

8. Domain d5bw7c1: 5bw7 C:10-86 [278024]
   Other proteins in same PDB: d5bw7a1, d5bw7a2, d5bw7b1, d5bw7b2
   automated match to d1fnla1
   complexed with bma, cl, fuc, gal, man, nag; mutant

Details for d5bw7c1

PDB Entry: 5bw7, 3 Å

PDB Description: crystal structure of nonfucosylated fc y296w mutant complexed with bis-glycosylated soluble form of fc gamma receptor iiia

PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor III-A

SCOPe Domain Sequences for d5bw7c1:

Sequence, based on SEQRES records:

>d5bw7c1 b.1.1.4 (C:10-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvddsgey
rcqtqlstlsdpvqlev

Sequence, based on observed residues (ATOM records):

>d5bw7c1 b.1.1.4 (C:10-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vflepqwyrvlekdsvtlkcqqwfhneslissqassyfidaatvddsgeyrcqtqlstls
dpvqlev

Timeline for d5bw7c1:

• d5bw7c1 first appeared in SCOPe 2.05
  
• d5bw7c1 appears in SCOPe 2.07
  
• d5bw7c1 appears in the current release, SCOPe 2.08