Lineage for d5bw7c1 (5bw7 C:10-86)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2354769Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2354818Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2354827Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries)
    Uniprot O75015 23-189
  8. 2354844Domain d5bw7c1: 5bw7 C:10-86 [278024]
    Other proteins in same PDB: d5bw7a1, d5bw7a2, d5bw7b1, d5bw7b2
    automated match to d1fnla1
    complexed with bma, cl, fuc, gal, man, nag; mutant

Details for d5bw7c1

PDB Entry: 5bw7 (more details), 3 Å

PDB Description: crystal structure of nonfucosylated fc y296w mutant complexed with bis-glycosylated soluble form of fc gamma receptor iiia
PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor III-A

SCOPe Domain Sequences for d5bw7c1:

Sequence, based on SEQRES records: (download)

>d5bw7c1 b.1.1.4 (C:10-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
vflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvddsgey
rcqtqlstlsdpvqlev

Sequence, based on observed residues (ATOM records): (download)

>d5bw7c1 b.1.1.4 (C:10-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
vflepqwyrvlekdsvtlkcqqwfhneslissqassyfidaatvddsgeyrcqtqlstls
dpvqlev

SCOPe Domain Coordinates for d5bw7c1:

Click to download the PDB-style file with coordinates for d5bw7c1.
(The format of our PDB-style files is described here.)

Timeline for d5bw7c1: