SCOPe 2.06: Domain d5bqzf_: 5bqz F:

Lineage for d5bqzf_ (5bqz F:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (23 species)
   not a true protein

7. Species Influenza a virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [278011] (1 PDB entry)

8. Domain d5bqzf_: 5bqz F: [278023]
   Other proteins in same PDB: d5bqza_, d5bqzc_, d5bqze_
   automated match to d4d00d_
   complexed with gal, nag, sia

Details for d5bqzf_

PDB Entry: 5bqz, 2.89 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6) in complex with human-like receptor lstc

PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d5bqzf_:

Sequence; same for both SEQRES and ATOM records:

>d5bqzf_ h.3.1.0 (F:) automated matches {Influenza a virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrln

Timeline for d5bqzf_:

• d5bqzf_ first appeared in SCOPe 2.05
  
• d5bqzf_ appears in SCOPe 2.07
  
• d5bqzf_ appears in the current release, SCOPe 2.08