![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
![]() | Superfamily b.72.1: WW domain [51045] (2 families) ![]() |
![]() | Family b.72.1.1: WW domain [51046] (13 proteins) |
![]() | Protein Mitotic rotamase PIN1 [51047] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [51048] (40 PDB entries) |
![]() | Domain d1pina1: 1pin A:6-39 [27802] Other proteins in same PDB: d1pina2 complexed with 1pg, ala, pro, so4 |
PDB Entry: 1pin (more details), 1.35 Å
SCOPe Domain Sequences for d1pina1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} klppgwekrmsrssgrvyyfnhitnasqwerpsg
Timeline for d1pina1: