Lineage for d5bqze_ (5bqz E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2385903Species Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275806] (2 PDB entries)
  8. 2385909Domain d5bqze_: 5bqz E: [278017]
    Other proteins in same PDB: d5bqzb_, d5bqzd_, d5bqzf_
    automated match to d3htta_
    complexed with gal, nag, sia

Details for d5bqze_

PDB Entry: 5bqz (more details), 2.89 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6) in complex with human-like receptor lstc
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5bqze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bqze_ b.19.1.0 (E:) automated matches {Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
igecpkyvkskslrlatglrnvp

SCOPe Domain Coordinates for d5bqze_:

Click to download the PDB-style file with coordinates for d5bqze_.
(The format of our PDB-style files is described here.)

Timeline for d5bqze_: