Lineage for d5bqzb_ (5bqz B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1970237Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 1970238Protein automated matches [254645] (10 species)
    not a true protein
  7. 1970246Species Influenza a virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [278011] (1 PDB entry)
  8. 1970247Domain d5bqzb_: 5bqz B: [278015]
    Other proteins in same PDB: d5bqza_, d5bqzc_, d5bqze_
    automated match to d4d00d_
    complexed with gal, nag, sia

Details for d5bqzb_

PDB Entry: 5bqz (more details), 2.89 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6) in complex with human-like receptor lstc
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5bqzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bqzb_ h.3.1.0 (B:) automated matches {Influenza a virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnr

SCOPe Domain Coordinates for d5bqzb_:

Click to download the PDB-style file with coordinates for d5bqzb_.
(The format of our PDB-style files is described here.)

Timeline for d5bqzb_: