![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
![]() | Protein automated matches [254645] (42 species) not a true protein |
![]() | Species Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275804] (6 PDB entries) |
![]() | Domain d5bqzb_: 5bqz B: [278015] Other proteins in same PDB: d5bqza_, d5bqzc_, d5bqze_ automated match to d4d00d_ complexed with nag |
PDB Entry: 5bqz (more details), 2.89 Å
SCOPe Domain Sequences for d5bqzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bqzb_ h.3.1.0 (B:) automated matches {Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]} glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnr
Timeline for d5bqzb_: