Lineage for d5bqzd_ (5bqz D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (26 species)
    not a true protein
  7. 2592358Species Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275804] (5 PDB entries)
  8. 2592363Domain d5bqzd_: 5bqz D: [278013]
    Other proteins in same PDB: d5bqza_, d5bqzc_, d5bqze_
    automated match to d4d00d_
    complexed with gal, nag, sia

Details for d5bqzd_

PDB Entry: 5bqz (more details), 2.89 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6) in complex with human-like receptor lstc
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d5bqzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bqzd_ h.3.1.0 (D:) automated matches {Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqki

SCOPe Domain Coordinates for d5bqzd_:

Click to download the PDB-style file with coordinates for d5bqzd_.
(The format of our PDB-style files is described here.)

Timeline for d5bqzd_: