Lineage for d1uok_1 (1uok 480-558)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins) 
Protein Oligo-1,6-glucosidase [51042] (1 species) Species Bacillus cereus [TaxId:1396] [51043] (1 PDB entry) 
Domain d1uok_1: 1uok 480-558 [27801]
Other proteins in same PDB: d1uok_2
Details for d1uok_1
PDB Entry: 1uok (more details), 2 Å
PDB Description: crystal structure of b. cereus oligo-1,6-glucosidase
SCOP Domain Sequences for d1uok_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uok_1 b.71.1.1 (480-558) Oligo-1,6-glucosidase {Bacillus cereus}
gsydlilennpsifayvrtygvekllvianftaeecifelpedisysevellihnydven
gpienitlrpyeamvfklk
SCOP Domain Coordinates for d1uok_1:
Click to download the PDB-style file with coordinates for d1uok_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uok_1:
- d1uok_1 first appeared (with stable ids) in SCOP 1.55
- d1uok_1 appears in SCOP 1.59
- d1uok_1 appears in the current release, SCOPe 2.08, called d1uoka1
View in 3D
