Lineage for d5bnqa_ (5bnq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777555Protein automated matches [190204] (3 species)
    not a true protein
  7. 2777556Species Human (Homo sapiens) [TaxId:9606] [186956] (13 PDB entries)
  8. 2777582Domain d5bnqa_: 5bnq A: [278008]
    automated match to d3urfa_
    complexed with cl, na, po4

Details for d5bnqa_

PDB Entry: 5bnq (more details), 2.8 Å

PDB Description: crystal structure of hrankl-mrank complex
PDB Compounds: (A:) tumor necrosis factor ligand superfamily member 11

SCOPe Domain Sequences for d5bnqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnqa_ b.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqpfahltinatdipsgshkvslsswyhdrgwakisnmtfsngklivnqdgfyylyanic
frhhetsgdlateylqlmvyvtktsikipsshtlmkggstkywsgnsefhfysinvggff
klrsgeeisievsnpslldpdqdatyfgafkvrdid

SCOPe Domain Coordinates for d5bnqa_:

Click to download the PDB-style file with coordinates for d5bnqa_.
(The format of our PDB-style files is described here.)

Timeline for d5bnqa_: