Lineage for d5aaua1 (5aau A:307-552)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009538Domain d5aaua1: 5aau A:307-552 [278006]
    Other proteins in same PDB: d5aaua2
    automated match to d3erta_
    complexed with xbr

Details for d5aaua1

PDB Entry: 5aau (more details), 1.9 Å

PDB Description: optimization of a novel binding motif to to (e)-3-(3,5- difluoro-4-((1r,3r)-2-(2-fluoro-2-methylpropyl)-3-methyl-2, 3,4,9-tetrahydro-1h-pyrido(3,4-b)indol-1-yl)phenyl)acrylic acid (azd9496), a potent and orally bioavailable selective estrogen receptor downregulator and antagonist
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d5aaua1:

Sequence, based on SEQRES records: (download)

>d5aaua1 a.123.1.1 (A:307-552) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemlda
hrlhap

Sequence, based on observed residues (ATOM records): (download)

>d5aaua1 a.123.1.1 (A:307-552) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseysmmglltnladrelvhminwakrvpgfvdltlhdq
vhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatssrf
rmmnlqgeefvclksiillnsgvytfeekdhihrvldkitdtlihlmakagltlqqqhqr
laqlllilshirhmsnkgmehlysmvvpsydlllemldahrlhap

SCOPe Domain Coordinates for d5aaua1:

Click to download the PDB-style file with coordinates for d5aaua1.
(The format of our PDB-style files is described here.)

Timeline for d5aaua1:

  • d5aaua1 first appeared in SCOPe 2.05, called d5aaua_

View in 3D
Domains from same chain:
(mouse over for more information)
d5aaua2
View in 3D
Domains from other chains:
(mouse over for more information)
d5aaub_