Lineage for d4zo0b_ (4zo0 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204604Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2204605Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2204652Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins)
    automatically mapped to Pfam PF08724
  6. 2204664Protein automated matches [277252] (2 species)
    not a true protein
  7. 2204665Species Adeno-associated virus 2 (isolate srivastava/1982) [TaxId:648242] [277998] (1 PDB entry)
  8. 2204667Domain d4zo0b_: 4zo0 B: [278000]
    Other proteins in same PDB: d4zo0c2
    automated match to d1uuta_
    complexed with ipa, mg

Details for d4zo0b_

PDB Entry: 4zo0 (more details), 2.3 Å

PDB Description: x-ray structure of aav-2 origin binding domain
PDB Compounds: (B:) Protein Rep68

SCOPe Domain Sequences for d4zo0b_:

Sequence, based on SEQRES records: (download)

>d4zo0b_ d.89.1.3 (B:) automated matches {Adeno-associated virus 2 (isolate srivastava/1982) [TaxId: 648242]}
mpgfyeivikvpsdldehlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaeklq
rdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqri
yrgieptlpnwfavtktrngagggnkvvdesyipnyllpktqpelqwawtnmeqylsacl
nlterkrlvaqhlthvsqtqe

Sequence, based on observed residues (ATOM records): (download)

>d4zo0b_ d.89.1.3 (B:) automated matches {Adeno-associated virus 2 (isolate srivastava/1982) [TaxId: 648242]}
mpgfyeivikvpsdldehlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaeklq
rdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqri
yrgieptlpnwfavtktrnggnkvvdesyipnyllpktqpelqwawtnmeqylsaclnlt
erkrlvaqhlthvsqtqe

SCOPe Domain Coordinates for d4zo0b_:

Click to download the PDB-style file with coordinates for d4zo0b_.
(The format of our PDB-style files is described here.)

Timeline for d4zo0b_: