Lineage for d4ygod_ (4ygo D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969531Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries)
  8. 2969619Domain d4ygod_: 4ygo D: [277991]
    automated match to d3eg7b_
    complexed with ca, moh

Details for d4ygod_

PDB Entry: 4ygo (more details), 2.5 Å

PDB Description: dodecameric structure of spermidine n-acetyltransferase from vibrio cholerae in intermediate state
PDB Compounds: (D:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d4ygod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ygod_ d.108.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse

SCOPe Domain Coordinates for d4ygod_:

Click to download the PDB-style file with coordinates for d4ygod_.
(The format of our PDB-style files is described here.)

Timeline for d4ygod_: