Lineage for d1amya1 (1amy A:347-403)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400341Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2400728Protein Plant alpha-amylase [51040] (2 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 2400739Species Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId:4513] [51041] (3 PDB entries)
  8. 2400743Domain d1amya1: 1amy A:347-403 [27799]
    Other proteins in same PDB: d1amya2
    complexed with ca

Details for d1amya1

PDB Entry: 1amy (more details), 2.8 Å

PDB Description: crystal and molecular structure of barley alpha-amylase
PDB Compounds: (A:) 1,4-alpha-d-glucan glucanohydrolase

SCOPe Domain Sequences for d1amya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1amya1 b.71.1.1 (A:347-403) Plant alpha-amylase {Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId: 4513]}
hnesklqiieadadlylaeidgkvivklgprydvgnlipggfkvaahgndyavweki

SCOPe Domain Coordinates for d1amya1:

Click to download the PDB-style file with coordinates for d1amya1.
(The format of our PDB-style files is described here.)

Timeline for d1amya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1amya2