![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Clostridium acetobutylicum [TaxId:863638] [260180] (4 PDB entries) |
![]() | Domain d4xl4a2: 4xl4 A:270-392 [277987] automated match to d4n46b2 complexed with coa, gol |
PDB Entry: 4xl4 (more details), 1.9 Å
SCOPe Domain Sequences for d4xl4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xl4a2 c.95.1.0 (A:270-392) automated matches {Clostridium acetobutylicum [TaxId: 863638]} kplakivsygsagvdpaimgygpfyatkaaiekagwtvdeldliesneafaaqslavakd lkfdmnkvnvnggaialghpigasgarilvtlvhamqkrdakkglatlsigggqgtaill ekc
Timeline for d4xl4a2: