SCOPe 2.06: Domain d4xl2a2: 4xl2 A:270-392

Lineage for d4xl2a2 (4xl2 A:270-392)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Clostridium acetobutylicum [TaxId:272562] [277964] (2 PDB entries)

8. Domain d4xl2a2: 4xl2 A:270-392 [277979]
   Other proteins in same PDB: d4xl2a3, d4xl2b3
   automated match to d4n46b2
   complexed with act, gol, peg

Details for d4xl2a2

PDB Entry: 4xl2, 1.77 Å

PDB Description: crystal structure of oxidized form of thiolase from clostridium acetobutylicum

PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4xl2a2:

Sequence, based on SEQRES records:

>d4xl2a2 c.95.1.0 (A:270-392) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
kplakivsygsagvdpaimgygpfyatkaaiekagwtvdeldliesneafaaqslavakd
lkfdmnkvnvnggaialghpigasgarilvtlvhamqkrdakkglatlcigggqgtaill
ekc

Sequence, based on observed residues (ATOM records):

>d4xl2a2 c.95.1.0 (A:270-392) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
kplakivsygsagpfyatkaaiekagwtvdeldliesneafaaqslavakdlkfdmnkvn
vnggaialghpigasgarilvtlvhamqkrdakkglatlcigggqgtaillekc

Timeline for d4xl2a2:

• d4xl2a2 first appeared in SCOPe 2.05
  
• d4xl2a2 appears in SCOPe 2.07
  
• d4xl2a2 appears in the current release, SCOPe 2.08