Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (52 species) not a true protein |
Species Clostridium acetobutylicum [TaxId:272562] [277964] (2 PDB entries) |
Domain d4xl2a1: 4xl2 A:1-269 [277978] automated match to d4n46b1 complexed with act, gol, peg |
PDB Entry: 4xl2 (more details), 1.77 Å
SCOPe Domain Sequences for d4xl2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xl2a1 c.95.1.0 (A:1-269) automated matches {Clostridium acetobutylicum [TaxId: 272562]} mkevviasavrtaigsygkslkdvpavdlgataikeavkkagikpedvnevilgnvlqag lgqnparqasfkaglpveipamtinkvcgsglrtvslaaqiikagdadviiaggmenmsr apylannarwgyrmgnakfvdemitdglwdafndyhmgitaeniaerwnisreeqdefal asqkkaeeaiksgqfkdeivpvvikgrkgetvvdtdehprfgstieglaklkpafkkdgt vtagnasglndcaavlvimsaekakelgv
Timeline for d4xl2a1: