SCOPe 2.05: Domain d1avaa1: 1ava A:347-403

Lineage for d1avaa1 (1ava A:347-403)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Plant alpha-amylase [51040] (2 species)
   single beta-sheet; probable result of a decay of the common-fold

7. Species Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId:4513] [51041] (3 PDB entries)

8. Domain d1avaa1: 1ava A:347-403 [27797]
   Other proteins in same PDB: d1avaa2, d1avab2, d1avac_, d1avad_
   complexed with ca

Details for d1avaa1

PDB Entry: 1ava, 1.9 Å

PDB Description: amy2/basi protein-protein complex from barley seed

PDB Compounds: (A:) barley alpha-amylase 2(cv menuet)

SCOPe Domain Sequences for d1avaa1:

Sequence; same for both SEQRES and ATOM records:

>d1avaa1 b.71.1.1 (A:347-403) Plant alpha-amylase {Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId: 4513]}
hnesklqiieadadlylaeidgkvivklgprydvgnlipggfkvaahgndyavweki

Timeline for d1avaa1:

• d1avaa1 first appeared (with stable ids) in SCOP 1.55
  
• d1avaa1 appears in SCOPe 2.04
  
• d1avaa1 appears in SCOPe 2.06
  
• d1avaa1 appears in the current release, SCOPe 2.08