Lineage for d1avaa1 (1ava A:347-403)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63143Protein Plant alpha-amylase [51040] (1 species)
  7. 63144Species Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId:4513] [51041] (3 PDB entries)
  8. 63145Domain d1avaa1: 1ava A:347-403 [27797]
    Other proteins in same PDB: d1avaa2, d1avab2, d1avac_, d1avad_

Details for d1avaa1

PDB Entry: 1ava (more details), 1.9 Å

PDB Description: amy2/basi protein-protein complex from barley seed

SCOP Domain Sequences for d1avaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avaa1 b.71.1.1 (A:347-403) Plant alpha-amylase {Barley (Hordeum vulgare), seeds, AMY2 isozyme}
hnesklqiieadadlylaeidgkvivklgprydvgnlipggfkvaahgndyavweki

SCOP Domain Coordinates for d1avaa1:

Click to download the PDB-style file with coordinates for d1avaa1.
(The format of our PDB-style files is described here.)

Timeline for d1avaa1:

63145
d1avaa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1avaa2