Lineage for d4wyra1 (4wyr A:1-269)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2524801Species Clostridium acetobutylicum [TaxId:272562] [277964] (2 PDB entries)
  8. 2524806Domain d4wyra1: 4wyr A:1-269 [277965]
    automated match to d4n46b1
    complexed with gol, peg; mutant

Details for d4wyra1

PDB Entry: 4wyr (more details), 2.3 Å

PDB Description: crystal structure of thiolase mutation (v77q,n153y,a286k) from clostridium acetobutylicum
PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4wyra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wyra1 c.95.1.0 (A:1-269) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
mkevviasavrtaigsygkslkdvpavdlgataikeavkkagikpedvnevilgnvlqag
lgqnparqasfkaglpqeipamtinkvcgsglrtvslaaqiikagdadviiaggmenmsr
apylannarwgyrmgnakfvdemitdglwdafydyhmgitaeniaerwnisreeqdefal
asqkkaeeaiksgqfkdeivpvvikgrkgetvvdtdehprfgstieglaklkpafkkdgt
vtagnasglndcaavlvimsaekakelgv

SCOPe Domain Coordinates for d4wyra1:

Click to download the PDB-style file with coordinates for d4wyra1.
(The format of our PDB-style files is described here.)

Timeline for d4wyra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wyra2