| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (83 species) not a true protein |
| Species Clostridium acetobutylicum [TaxId:272562] [277964] (2 PDB entries) |
| Domain d4wyra1: 4wyr A:1-269 [277965] automated match to d4n46b1 complexed with gol, peg; mutant |
PDB Entry: 4wyr (more details), 2.3 Å
SCOPe Domain Sequences for d4wyra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wyra1 c.95.1.0 (A:1-269) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
mkevviasavrtaigsygkslkdvpavdlgataikeavkkagikpedvnevilgnvlqag
lgqnparqasfkaglpqeipamtinkvcgsglrtvslaaqiikagdadviiaggmenmsr
apylannarwgyrmgnakfvdemitdglwdafydyhmgitaeniaerwnisreeqdefal
asqkkaeeaiksgqfkdeivpvvikgrkgetvvdtdehprfgstieglaklkpafkkdgt
vtagnasglndcaavlvimsaekakelgv
Timeline for d4wyra1: