SCOPe 2.08: Domain d4v1de1: 4v1d E:140-250

Lineage for d4v1de1 (4v1d E:140-250)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4v1de1: 4v1d E:140-250 [277959]
   Other proteins in same PDB: d4v1da_, d4v1db2, d4v1dc_, d4v1dd_, d4v1de2
   automated match to d1rvfl_

Details for d4v1de1

PDB Entry: 4v1d, 3.1 Å

PDB Description: ternary complex among two human derived single chain antibody fragments and cn2 toxin from scorpion centruroides noxius.

PDB Compounds: (E:) single chain antibody fragment ru1, light chain

SCOPe Domain Sequences for d4v1de1:

Sequence; same for both SEQRES and ATOM records:

>d4v1de1 b.1.1.0 (E:140-250) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsasgtpgqrvtiscsgsssnigsntvnwyrhlpgsapelligshnqrpsgvp
drfsasksdtsaslaisglqsedeadyycaawddsligyvfgtgtkltvlg

Timeline for d4v1de1:

• d4v1de1 first appeared in SCOPe 2.05, called d4v1de_
  
• d4v1de1 was called d4v1de_ in SCOPe 2.07