SCOPe 2.06: Domain d4wi0a_: 4wi0 A:

Lineage for d4wi0a_ (4wi0 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Cellulosomal scaffoldin adaptor protein B, ScaB [110073] (1 species)

7. Species Acetivibrio cellulolyticus [TaxId:35830] [110074] (8 PDB entries)
   Uniprot Q7WYN3 29-199

8. Domain d4wi0a_: 4wi0 A: [277954]
   Other proteins in same PDB: d4wi0b1, d4wi0b2
   automated match to d3fnkb_
   complexed with ca; mutant

Details for d4wi0a_

PDB Entry: 4wi0, 1.93 Å

PDB Description: crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus

PDB Compounds: (A:) Cellulosomal scaffoldin adaptor protein B

SCOPe Domain Sequences for d4wi0a_:

Sequence; same for both SEQRES and ATOM records:

>d4wi0a_ b.2.2.2 (A:) Cellulosomal scaffoldin adaptor protein B, ScaB {Acetivibrio cellulolyticus [TaxId: 35830]}
mesyitmnfdkntaevgqiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytns
slptsgellvnedygpivqgvhkisegilnlsrsytaldvyrasespeetgtvavvgfka
lqkkattvvfehsvtmpngiigttlfnwygnritsgysviqpgeinse

Timeline for d4wi0a_:

• d4wi0a_ first appeared in SCOPe 2.05
  
• d4wi0a_ appears in SCOPe 2.07
  
• d4wi0a_ appears in the current release, SCOPe 2.08