SCOPe 2.08: Domain d4wi0b2: 4wi0 B:123-184

Lineage for d4wi0b2 (4wi0 B:123-184)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.139: Type I dockerin domain [63445] (1 superfamily)
   tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand

4. Superfamily a.139.1: Type I dockerin domain [63446] (2 families)

5. Family a.139.1.0: automated matches [191542] (1 protein)
   not a true family

6. Protein automated matches [190928] (7 species)
   not a true protein

7. Species Acetivibrio cellulolyticus [TaxId:35830] [271532] (6 PDB entries)

8. Domain d4wi0b2: 4wi0 B:123-184 [277953]
   Other proteins in same PDB: d4wi0a_, d4wi0b1
   automated match to d2b59b1
   complexed with ca; mutant

Details for d4wi0b2

PDB Entry: 4wi0, 1.93 Å

PDB Description: crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus

PDB Compounds: (B:) cellulosomal scaffoldin

SCOPe Domain Sequences for d4wi0b2:

Sequence; same for both SEQRES and ATOM records:

>d4wi0b2 a.139.1.0 (B:123-184) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
aiggtqdgainledileickafntsstdakyqvgldlnrdgaisledvmivakhfgkvss
dy

Timeline for d4wi0b2:

• d4wi0b2 first appeared in SCOPe 2.05
  
• d4wi0b2 appears in SCOPe 2.07