![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) ![]() |
![]() | Family b.3.2.0: automated matches [275446] (1 protein) not a true family |
![]() | Protein automated matches [275447] (1 species) not a true protein |
![]() | Species Acetivibrio cellulolyticus [TaxId:35830] [275448] (2 PDB entries) |
![]() | Domain d4wi0b1: 4wi0 B:29-122 [277952] Other proteins in same PDB: d4wi0a_, d4wi0b2 automated match to d2b59b2 complexed with ca; mutant |
PDB Entry: 4wi0 (more details), 1.93 Å
SCOPe Domain Sequences for d4wi0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wi0b1 b.3.2.0 (B:29-122) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]} gttvsgyinpdfvttsttapivkagftveivgttksavtdsngyfeikdvaagtytvkit kanyltreianvsvtadkelstsaspilmwagdm
Timeline for d4wi0b1: