Lineage for d4wi0b1 (4wi0 B:29-122)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768765Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) (S)
  5. 2768781Family b.3.2.0: automated matches [275446] (1 protein)
    not a true family
  6. 2768782Protein automated matches [275447] (3 species)
    not a true protein
  7. 2768783Species Acetivibrio cellulolyticus [TaxId:35830] [275448] (2 PDB entries)
  8. 2768785Domain d4wi0b1: 4wi0 B:29-122 [277952]
    Other proteins in same PDB: d4wi0a_, d4wi0b2
    automated match to d2b59b2
    complexed with ca; mutant

Details for d4wi0b1

PDB Entry: 4wi0 (more details), 1.93 Å

PDB Description: crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
PDB Compounds: (B:) cellulosomal scaffoldin

SCOPe Domain Sequences for d4wi0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wi0b1 b.3.2.0 (B:29-122) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
gttvsgyinpdfvttsttapivkagftveivgttksavtdsngyfeikdvaagtytvkit
kanyltreianvsvtadkelstsaspilmwagdm

SCOPe Domain Coordinates for d4wi0b1:

Click to download the PDB-style file with coordinates for d4wi0b1.
(The format of our PDB-style files is described here.)

Timeline for d4wi0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wi0b2
View in 3D
Domains from other chains:
(mouse over for more information)
d4wi0a_