Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (24 species) not a true protein |
Species Escherichia coli [TaxId:83333] [277890] (10 PDB entries) |
Domain d4s1fk1: 4s1f K:2-220 [277936] Other proteins in same PDB: d4s1fa2, d4s1fb2, d4s1fc2, d4s1fd2, d4s1fe2, d4s1ff2, d4s1fg2, d4s1fh2, d4s1fi2, d4s1fj2, d4s1fk2, d4s1fl2, d4s1fm2, d4s1fn2, d4s1fo2, d4s1fp2, d4s1fq2, d4s1fr2, d4s1fs2, d4s1ft2 automated match to d1l6wa_ complexed with p2d |
PDB Entry: 4s1f (more details), 2.24 Å
SCOPe Domain Sequences for d4s1fk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s1fk1 c.1.10.1 (K:2-220) automated matches {Escherichia coli [TaxId: 83333]} elyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqvm attaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgllsa lagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllagc esitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
Timeline for d4s1fk1:
View in 3D Domains from other chains: (mouse over for more information) d4s1fa1, d4s1fa2, d4s1fb1, d4s1fb2, d4s1fc1, d4s1fc2, d4s1fd1, d4s1fd2, d4s1fe1, d4s1fe2, d4s1ff1, d4s1ff2, d4s1fg1, d4s1fg2, d4s1fh1, d4s1fh2, d4s1fi1, d4s1fi2, d4s1fj1, d4s1fj2, d4s1fl1, d4s1fl2, d4s1fm1, d4s1fm2, d4s1fn1, d4s1fn2, d4s1fo1, d4s1fo2, d4s1fp1, d4s1fp2, d4s1fq1, d4s1fq2, d4s1fr1, d4s1fr2, d4s1fs1, d4s1fs2, d4s1ft1, d4s1ft2 |