Lineage for d4s1fg1 (4s1f G:2-220)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443602Protein automated matches [190095] (28 species)
    not a true protein
  7. 2443728Species Escherichia coli [TaxId:83333] [277890] (11 PDB entries)
  8. 2443775Domain d4s1fg1: 4s1f G:2-220 [277931]
    Other proteins in same PDB: d4s1fa2, d4s1fb2, d4s1fc2, d4s1fd2, d4s1fe2, d4s1ff2, d4s1fg2, d4s1fh2, d4s1fi2, d4s1fj2, d4s1fk2, d4s1fl2, d4s1fm2, d4s1fn2, d4s1fo2, d4s1fp2, d4s1fq2, d4s1fr2, d4s1fs2, d4s1ft2
    automated match to d1l6wa_
    complexed with p2d

Details for d4s1fg1

PDB Entry: 4s1f (more details), 2.24 Å

PDB Description: fructose-6-phosphate aldolase a from e.coli soaked in acetylacetone
PDB Compounds: (G:) Fructose-6-phosphate aldolase 1

SCOPe Domain Sequences for d4s1fg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s1fg1 c.1.10.1 (G:2-220) automated matches {Escherichia coli [TaxId: 83333]}
elyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqvm
attaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgllsa
lagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllagc
esitlpldvaqqmisypavdaavakfeqdwqgafgrtsi

SCOPe Domain Coordinates for d4s1fg1:

Click to download the PDB-style file with coordinates for d4s1fg1.
(The format of our PDB-style files is described here.)

Timeline for d4s1fg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4s1fg2