Lineage for d4s1fc_ (4s1f C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1822171Protein automated matches [190095] (20 species)
    not a true protein
  7. 1822259Species Escherichia coli [TaxId:83333] [277890] (6 PDB entries)
  8. 1822286Domain d4s1fc_: 4s1f C: [277928]
    automated match to d1l6wa_
    complexed with p2d

Details for d4s1fc_

PDB Entry: 4s1f (more details), 2.24 Å

PDB Description: fructose-6-phosphate aldolase a from e.coli soaked in acetylacetone
PDB Compounds: (C:) Fructose-6-phosphate aldolase 1

SCOPe Domain Sequences for d4s1fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s1fc_ c.1.10.1 (C:) automated matches {Escherichia coli [TaxId: 83333]}
helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi

SCOPe Domain Coordinates for d4s1fc_:

Click to download the PDB-style file with coordinates for d4s1fc_.
(The format of our PDB-style files is described here.)

Timeline for d4s1fc_:

  • d4s1fc_ appears in periodic updates to SCOPe 2.05 starting on 2015-10-08
  • d4s1fc_ is called d4s1fc1 in SCOPe 2.06
  • d4s1fc_ appears in the current release, SCOPe 2.07, called d4s1fc1