Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) [51038] (1 species) single beta-sheet; probable result of a decay of the common-fold |
Species Pseudomonas stutzeri [TaxId:316] [51039] (9 PDB entries) |
Domain d1qi5a1: 1qi5 A:358-418 [27792] Other proteins in same PDB: d1qi5a2 complexed with ca, mtt; mutant |
PDB Entry: 1qi5 (more details), 2 Å
SCOPe Domain Sequences for d1qi5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qi5a1 b.71.1.1 (A:358-418) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} radsaisfhsgysglvatvsgsqqtlvvalnsdlgnpgqvasgsfseavnasngqvrvwr s
Timeline for d1qi5a1: