Lineage for d1qi5a1 (1qi5 A:358-418)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2077112Protein G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) [51038] (1 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 2077113Species Pseudomonas stutzeri [TaxId:316] [51039] (9 PDB entries)
  8. 2077121Domain d1qi5a1: 1qi5 A:358-418 [27792]
    Other proteins in same PDB: d1qi5a2
    complexed with ca, mtt; mutant

Details for d1qi5a1

PDB Entry: 1qi5 (more details), 2 Å

PDB Description: mutant (d294n) maltotetraose-forming exo-amylase in complex with maltotetraose
PDB Compounds: (A:) protein (exo-maltotetraohydrolase)

SCOPe Domain Sequences for d1qi5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qi5a1 b.71.1.1 (A:358-418) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]}
radsaisfhsgysglvatvsgsqqtlvvalnsdlgnpgqvasgsfseavnasngqvrvwr
s

SCOPe Domain Coordinates for d1qi5a1:

Click to download the PDB-style file with coordinates for d1qi5a1.
(The format of our PDB-style files is described here.)

Timeline for d1qi5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qi5a2