SCOPe 2.07: Domain d4rxfh1: 4rxf H:2-220

Lineage for d4rxfh1 (4rxf H:2-220)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [277890] (11 PDB entries)

8. Domain d4rxfh1: 4rxf H:2-220 [277896]
   Other proteins in same PDB: d4rxfa2, d4rxfb2, d4rxfc2, d4rxfd2, d4rxfe2, d4rxff2, d4rxfg2, d4rxfh2, d4rxfi2, d4rxfj2
   automated match to d1l6wa_
   complexed with po4

Details for d4rxfh1

PDB Entry: 4rxf, 2.4 Å

PDB Description: fructose-6-phosphate aldolase y131f from e.coli

PDB Compounds: (H:) Fructose-6-phosphate aldolase 1

SCOPe Domain Sequences for d4rxfh1:

Sequence; same for both SEQRES and ATOM records:

>d4rxfh1 c.1.10.1 (H:2-220) automated matches {Escherichia coli [TaxId: 83333]}
elyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqvm
attaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgllsa
lagaeyvapfvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllagc
esitlpldvaqqmisypavdaavakfeqdwqgafgrtsi

Timeline for d4rxfh1:

• d4rxfh1 first appeared in SCOPe 2.05, called d4rxfh_
  
• d4rxfh1 appears in SCOPe 2.06
  
• d4rxfh1 appears in the current release, SCOPe 2.08