Lineage for d4rxfe1 (4rxf E:2-220)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835105Species Escherichia coli [TaxId:83333] [277890] (11 PDB entries)
  8. 2835170Domain d4rxfe1: 4rxf E:2-220 [277891]
    Other proteins in same PDB: d4rxfa2, d4rxfb2, d4rxfc2, d4rxfd2, d4rxfe2, d4rxff2, d4rxfg2, d4rxfh2, d4rxfi2, d4rxfj2
    automated match to d1l6wa_
    complexed with po4

Details for d4rxfe1

PDB Entry: 4rxf (more details), 2.4 Å

PDB Description: fructose-6-phosphate aldolase y131f from e.coli
PDB Compounds: (E:) Fructose-6-phosphate aldolase 1

SCOPe Domain Sequences for d4rxfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rxfe1 c.1.10.1 (E:2-220) automated matches {Escherichia coli [TaxId: 83333]}
elyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqvm
attaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgllsa
lagaeyvapfvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllagc
esitlpldvaqqmisypavdaavakfeqdwqgafgrtsi

SCOPe Domain Coordinates for d4rxfe1:

Click to download the PDB-style file with coordinates for d4rxfe1.
(The format of our PDB-style files is described here.)

Timeline for d4rxfe1: