| Root: SCOPe 2.08 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
| Protein automated matches [190095] (28 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [277890] (11 PDB entries) |
| Domain d4rxfe1: 4rxf E:2-220 [277891] Other proteins in same PDB: d4rxfa2, d4rxfb2, d4rxfc2, d4rxfd2, d4rxfe2, d4rxff2, d4rxfg2, d4rxfh2, d4rxfi2, d4rxfj2 automated match to d1l6wa_ complexed with po4 |
PDB Entry: 4rxf (more details), 2.4 Å
SCOPe Domain Sequences for d4rxfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rxfe1 c.1.10.1 (E:2-220) automated matches {Escherichia coli [TaxId: 83333]}
elyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqvm
attaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgllsa
lagaeyvapfvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllagc
esitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
Timeline for d4rxfe1: