Lineage for d4r53c_ (4r53 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836165Species Campylobacter jejuni [TaxId:192222] [268320] (5 PDB entries)
  8. 2836176Domain d4r53c_: 4r53 C: [277887]
    automated match to d3m5vb_
    complexed with cl, edo, peg, pg4, pge

Details for d4r53c_

PDB Entry: 4r53 (more details), 2 Å

PDB Description: dihydrodipicolinate synthase from c. jejuni with vacant active site and vacant allosteric site
PDB Compounds: (C:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d4r53c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r53c_ c.1.10.0 (C:) automated matches {Campylobacter jejuni [TaxId: 192222]}
niiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtci
eiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqglyehy
kaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvkeasgnidkcvdllahep
rmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyni
nkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d4r53c_:

Click to download the PDB-style file with coordinates for d4r53c_.
(The format of our PDB-style files is described here.)

Timeline for d4r53c_: