Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein Galectin-1 [100925] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [101638] (32 PDB entries) Uniprot P09382 |
Domain d4q26g_: 4q26 G: [277882] automated match to d1gzwa_ complexed with gol, nlc |
PDB Entry: 4q26 (more details), 1.4 Å
SCOPe Domain Sequences for d4q26g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q26g_ b.29.1.3 (G:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]} cglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivcn skdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainyma adgdfkikcvafd
Timeline for d4q26g_: