SCOPe 2.06: Domain d4q1ra_: 4q1r A:

Lineage for d4q1ra_ (4q1r A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (27 PDB entries)
   Uniprot P09382

8. Domain d4q1ra_: 4q1r A: [277874]
   automated match to d1gzwa_
   complexed with 2xu, so4

Details for d4q1ra_

PDB Entry: 4q1r, 1.47 Å

PDB Description: galectin-1 in complex with ligand an027

PDB Compounds: (A:) galectin-1

SCOPe Domain Sequences for d4q1ra_:

Sequence; same for both SEQRES and ATOM records:

>d4q1ra_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
cglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivcn
skdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainyma
adgdfkikcvafd

Timeline for d4q1ra_:

• d4q1ra_ first appeared in SCOPe 2.05
  
• d4q1ra_ appears in SCOPe 2.07
  
• d4q1ra_ appears in the current release, SCOPe 2.08